PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_81763g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 235aa    MW: 26502.9 Da    PI: 7.2914
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_81763g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.3e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+++++ +G g+W++ ++  g+ R++k+c+ rw ++l
    MA_81763g0010 14 KGAWTKEEDDRLIQYIQVHGEGCWRSLPKAAGLLRCGKSCRMRWINFL 61
                     79******************************99***********996 PP

2Myb_DNA-binding53.74.8e-1768112248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      g+++++Ed+l+++++++lG++ W++Ia +++ gRt++++k++w+++l
    MA_81763g0010  68 GNFSEDEDDLILKLHALLGNK-WSLIAGRLP-GRTDNEIKNYWNSHL 112
                      79*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-22564IPR009057Homeodomain-like
PROSITE profilePS5129415.716961IPR017930Myb domain
SuperFamilySSF466893.88E-2912108IPR009057Homeodomain-like
SMARTSM007171.5E-121363IPR001005SANT/Myb domain
PfamPF002496.0E-141460IPR001005SANT/Myb domain
CDDcd001672.64E-101661No hitNo description
PROSITE profilePS5129425.57762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2565117IPR009057Homeodomain-like
SMARTSM007171.9E-1566114IPR001005SANT/Myb domain
PfamPF002498.2E-1668112IPR001005SANT/Myb domain
CDDcd001672.25E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MGRAPCCPNG DRNKGAWTKE EDDRLIQYIQ VHGEGCWRSL PKAAGLLRCG KSCRMRWINF  60
LRPHLKQGNF SEDEDDLILK LHALLGNKWS LIAGRLPGRT DNEIKNYWNS HLQRKLISMG  120
IDPLTHRAFQ KNSLHYRSLP RDDTEPEITS SHEVVHDFFH CPSELSVASE QVSNAASGLA  180
RDGHPDLNLN LDLGLSITGP SIQAVRKENV VNSEEGESDL SEGKGYLVYP LLRLR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-29911622128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1184440.0BT118444.1 Picea glauca clone GQ04006_H12 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002315890.21e-80hypothetical protein POPTR_0010s12420g
SwissprotQ9SZP15e-80MYB4_ARATH; Transcription repressor MYB4
TrEMBLA9NTK01e-127A9NTK0_PICSI; Putative uncharacterized protein
STRINGPOPTR_0010s12420.13e-80(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.13e-81myb domain protein 4